Loading...
Statistics
Advertisement

Cloudsland
www.cloudslandmunnar.com/

Cloudslandmunnar.com

Advertisement
Cloudslandmunnar.com is hosted in United States / Phoenix . Cloudslandmunnar.com uses HTTPS protocol. Number of used technologies: 8. First technologies: Carousel, CSS, Html, Number of used javascripts: 13. First javascripts: Jquery-1.6.4.min.js, HoverIntent.js, Superfish.js, Number of used analytics tools: 0. Its server type is: Apache.

Technologies in use by Cloudslandmunnar.com

Technology

Number of occurences: 8
  • Carousel
  • CSS
  • Html
  • Html5
  • Javascript
  • jQuery Cycle
  • Php
  • SuperFish

Advertisement

Javascripts

Number of occurences: 13
  • jquery-1.6.4.min.js
  • hoverIntent.js
  • superfish.js
  • supersubs.js
  • jquery.jcarousel.pack.js
  • gallery.js
  • jquery.preloader.js
  • jquery.cycle.all.min.js
  • ajax_captcha.js
  • www.js

Server Type

  • Apache

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Cloudslandmunnar.com

SSL certificate

    • name: /OU=Domain Control Validated/OU=PositiveSSL/CN=modern-vm.net
    • subject:
      • OU:
        • 0: Domain Control Validated
        • 1: PositiveSSL
      • CN: modern-vm.net
    • hash: d98a3202
    • issuer:
      • C: GB
      • ST: Greater Manchester
      • L: Salford
      • O: COMODO CA Limited
      • CN: COMODO RSA Domain Validation Secure Server CA
    • version: 2
    • serialNumber: 272769130175070306978208256439176092627
    • validFrom: 160324000000Z
    • validTo: 170324235959Z
    • validFrom_time_t: 1458777600
    • validTo_time_t: 1490399999
    • extensions:
      • authorityKeyIdentifier: keyid:90:AF:6A:3A:94:5A:0B:D8:90:EA:12:56:73:DF:43:B4:3A:28:DA:E7
      • subjectKeyIdentifier: 85:B0:93:9C:15:D0:E8:5A:17:5F:D0:18:14:CE:80:BA:45:9A:2E:E1
      • keyUsage: Digital Signature, Key Encipherment
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • certificatePolicies: Policy: 1.3.6.1.4.1.6449.1.2.2.7 CPS: https://secure.comodo.com/CPS Policy: 2.23.140.1.2.1
      • crlDistributionPoints: Full Name: URI:http://crl.comodoca.com/COMODORSADomainValidationSecureServerCA.crl
      • authorityInfoAccess: CA Issuers - URI:http://crt.comodoca.com/COMODORSADomainValidationSecureServerCA.crt OCSP - URI:http://ocsp.comodoca.com
      • subjectAltName: DNS:modern-vm.net, DNS:www.modern-vm.net

Meta - Cloudslandmunnar.com

Number of occurences: 4
  • Name: robots
    Content: index, follow
  • Name: keywords
    Content:
  • Name: description
    Content:
  • Name:
    Content:

Server / Hosting

  • IP: 107.178.115.100
  • Latitude: 33.43
  • Longitude: -112.01
  • Country: United States
  • City: Phoenix

Rname

  • ns2.noc57.com
  • ns1.noc57.com
  • cloudslandmunnar.com

Target

  • postmaster.nocmonitoring.org

HTTP Header Response

HTTP/1.1 200 OK Date: Tue, 10 May 2016 02:10:28 GMT Server: Apache Content-Type: text/html X-Cache: MISS from s_xt40 X-Cache-Lookup: MISS from s_xt40:80 Via: 1.1 s_xt40 (squid/3.5.14) Connection: keep-alive

DNS

host: cloudslandmunnar.com
  1. class: IN
  2. ttl: 14400
  3. type: A
  4. ip: 107.178.115.100
host: cloudslandmunnar.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns2.noc57.com
host: cloudslandmunnar.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns1.noc57.com
host: cloudslandmunnar.com
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: ns1.noc57.com
  5. rname: postmaster.nocmonitoring.org
  6. serial: 2016040101
  7. refresh: 86400
  8. retry: 7200
  9. expire: 3600000
  10. minimum-ttl: 86400
host: cloudslandmunnar.com
  1. class: IN
  2. ttl: 14400
  3. type: MX
  4. pri: 0
  5. target: cloudslandmunnar.com
host: cloudslandmunnar.com
  1. class: IN
  2. ttl: 14400
  3. type: TXT
  4. txt: v=spf1 a mx include:relay.mailchannels.net ?all
  5. entries: Array

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.loudslandmunnar.com, www.cdloudslandmunnar.com, www.dloudslandmunnar.com, www.crloudslandmunnar.com, www.rloudslandmunnar.com, www.ctloudslandmunnar.com, www.tloudslandmunnar.com, www.cvloudslandmunnar.com, www.vloudslandmunnar.com, www.cfloudslandmunnar.com, www.floudslandmunnar.com, www.cgloudslandmunnar.com, www.gloudslandmunnar.com, www.chloudslandmunnar.com, www.hloudslandmunnar.com, www.cnloudslandmunnar.com, www.nloudslandmunnar.com, www.cmloudslandmunnar.com, www.mloudslandmunnar.com, www.cjloudslandmunnar.com, www.jloudslandmunnar.com, www.coudslandmunnar.com, www.cluoudslandmunnar.com, www.cuoudslandmunnar.com, www.cl8oudslandmunnar.com, www.c8oudslandmunnar.com, www.cl9oudslandmunnar.com, www.c9oudslandmunnar.com, www.cljoudslandmunnar.com, www.cjoudslandmunnar.com, www.cl0oudslandmunnar.com, www.c0oudslandmunnar.com, www.clmoudslandmunnar.com, www.cmoudslandmunnar.com, www.clpoudslandmunnar.com, www.cpoudslandmunnar.com, www.clooudslandmunnar.com, www.cooudslandmunnar.com, www.cludslandmunnar.com, www.clobudslandmunnar.com, www.clbudslandmunnar.com, www.clohudslandmunnar.com, www.clhudslandmunnar.com, www.clogudslandmunnar.com, www.clgudslandmunnar.com, www.clojudslandmunnar.com, www.cljudslandmunnar.com, www.clomudslandmunnar.com, www.clmudslandmunnar.com, www.clo udslandmunnar.com, www.cl udslandmunnar.com, www.clovudslandmunnar.com, www.clvudslandmunnar.com, www.clodslandmunnar.com, www.clouwdslandmunnar.com, www.clowdslandmunnar.com, www.clouedslandmunnar.com, www.cloedslandmunnar.com, www.clousdslandmunnar.com, www.closdslandmunnar.com, www.clouadslandmunnar.com, www.cloadslandmunnar.com, www.clouslandmunnar.com, www.cloudtslandmunnar.com, www.cloutslandmunnar.com, www.cloudgslandmunnar.com, www.clougslandmunnar.com, www.cloudbslandmunnar.com, www.cloubslandmunnar.com, www.cloudxslandmunnar.com, www.clouxslandmunnar.com, www.cloudsslandmunnar.com, www.clousslandmunnar.com, www.cloudfslandmunnar.com, www.cloufslandmunnar.com, www.cloudvslandmunnar.com, www.clouvslandmunnar.com, www.cloudyslandmunnar.com, www.clouyslandmunnar.com, www.cloudzslandmunnar.com, www.clouzslandmunnar.com, www.cloudaslandmunnar.com, www.clouaslandmunnar.com, www.cloudeslandmunnar.com, www.cloueslandmunnar.com, www.cloudrslandmunnar.com, www.clourslandmunnar.com, www.cloudlandmunnar.com, www.cloudselandmunnar.com, www.cloudelandmunnar.com, www.cloudswlandmunnar.com, www.cloudwlandmunnar.com, www.cloudsdlandmunnar.com, www.clouddlandmunnar.com, www.cloudsxlandmunnar.com, www.cloudxlandmunnar.com, www.cloudsflandmunnar.com, www.cloudflandmunnar.com, www.cloudsglandmunnar.com, www.cloudglandmunnar.com, www.cloudstlandmunnar.com, www.cloudtlandmunnar.com, www.cloudsandmunnar.com, www.cloudsluandmunnar.com, www.cloudsuandmunnar.com, www.cloudsl8andmunnar.com, www.clouds8andmunnar.com, www.cloudsl9andmunnar.com, www.clouds9andmunnar.com, www.cloudsljandmunnar.com, www.cloudsjandmunnar.com, www.cloudsl0andmunnar.com, www.clouds0andmunnar.com, www.cloudslmandmunnar.com, www.cloudsmandmunnar.com, www.cloudslpandmunnar.com, www.cloudspandmunnar.com, www.cloudsloandmunnar.com, www.cloudsoandmunnar.com, www.cloudslndmunnar.com, www.cloudslaondmunnar.com, www.cloudslondmunnar.com, www.cloudslapndmunnar.com, www.cloudslpndmunnar.com, www.cloudsla9ndmunnar.com, www.cloudsl9ndmunnar.com, www.cloudslandmunnar.com, www.cloudslndmunnar.com, www.cloudslaindmunnar.com, www.cloudslindmunnar.com, www.cloudslaundmunnar.com, www.cloudslundmunnar.com, www.cloudsladmunnar.com, www.cloudslanndmunnar.com, www.cloudslandmunnar.com, www.cloudslanhdmunnar.com, www.cloudslahdmunnar.com, www.cloudslanjdmunnar.com, www.cloudslajdmunnar.com, www.cloudslankdmunnar.com, www.cloudslakdmunnar.com, www.cloudslanldmunnar.com, www.cloudslaldmunnar.com, www.cloudslan dmunnar.com, www.cloudsla dmunnar.com, www.cloudslanmunnar.com, www.cloudslandtmunnar.com, www.cloudslantmunnar.com, www.cloudslandgmunnar.com, www.cloudslangmunnar.com, www.cloudslandbmunnar.com, www.cloudslanbmunnar.com, www.cloudslandxmunnar.com, www.cloudslanxmunnar.com, www.cloudslandsmunnar.com, www.cloudslansmunnar.com, www.cloudslandfmunnar.com, www.cloudslanfmunnar.com, www.cloudslandvmunnar.com, www.cloudslanvmunnar.com, www.cloudslandymunnar.com, www.cloudslanymunnar.com, www.cloudslandzmunnar.com, www.cloudslanzmunnar.com, www.cloudslandamunnar.com, www.cloudslanamunnar.com, www.cloudslandemunnar.com, www.cloudslanemunnar.com, www.cloudslandrmunnar.com, www.cloudslanrmunnar.com,

Other websites we recently analyzed

  1. Die Essgefährten | Die Essgefährten – Projektbüro und Ideenwerkstatt für Essen mit BIOgrafie. Unterwegs für ein gutes Bauchgefühl.
    Germany - 212.227.226.107
    Server software: Apache/2.2.15 (Unix) mod_ssl/2.2.15 OpenSSL/0.9.8e-fips-rhel5 mod_fastcgi/2.4.6
    Technology: CSS, Cufon, Fancybox, Html, Javascript, jQuery, Php, Pingback, Google Analytics, Wordpress
    Number of Javascript: 21
    Number of meta tags: 2
  2. atomicranchtexas.com
    United States - 208.91.197.27
    Server software: Apache
    Technology: Html
    Number of meta tags: 2
  3. LanternRadio.com
    Kirkland (United States) - 98.124.245.24
    Server software: Apache/2.2.15 (CentOS)
    Technology: Google Adsense, CSS, Html, Javascript, Php
    Number of Javascript: 2
    Number of meta tags: 3
  4. nerdekampanya.com
    United States - 208.91.197.27
    Server software: Apache
    Technology: Html
    Number of meta tags: 2
  5. Gingart - Magazine de Arte e Cultura
    Magazine de Arte e Cultura
    Portugal - 62.28.40.222
    G Analytics ID: UA-61447441-1
    Server software: Apache
    Technology: CSS, Font Awesome, Google Font API, Html, Html5, Javascript, jQuery, Php, Pingback, Google Analytics, Wordpress
    Number of Javascript: 14
    Number of meta tags: 5
  6. sylvie-jardin.fr
    Ma vie a basculé vers la lumière artistique,j'ai fait des stages et pris des cours de peinture avec cinq professeurs différent. Modelage au centre d'art à Alençon depuis cinq ans. Stage de sculpture et de maquillage sur Paris. Sept années de théatre clown. C'est une sorte de boulimie artistique. acceuillir l'émotion,la partager,la donner.
    Germany - 212.227.43.75
    Server software: Apache
    Technology: CSS, Google Font API, Html, Javascript, Google Analytics
    Number of Javascript: 1
    Number of meta tags: 10
  7. Dhanalakshmipaper « Paper World
    San Francisco (United States) - 104.28.16.118
    Server software: cloudflare-nginx
    Technology: CSS, Flexslider, Html, Javascript, jQuery Validate, Php, Pingback, Shortcodes, Wordpress
    Number of Javascript: 13
    Number of meta tags: 4
  8. GREENBRICK.COM
    Jacksonville (United States) - 205.178.189.131
    Server software: Sun-ONE-Web-Server/6.1
    Technology: Html
    Number of meta tags: 1
  9. imaphurricane.com
    Switzerland - 141.8.225.31
    Server software: Apache
    Technology: Html
  10. Welcome to poughkeepsiemedicalmalpracticelawyers.com
    Welcome to poughkeepsiemedicalmalpracticelawyers.com
    Dallas (United States) - 45.35.73.201
    Server software: nginx
    Technology: Google Adsense, Javascript, Php
    Number of Javascript: 5
    Number of meta tags: 4

Check Other Websites